Commit 5b3b8753 authored by Mathieu's avatar Mathieu

BUSCO beta 2.0

parent 577947b5
This source diff could not be displayed because it is too large. You can view the blob instead.
This diff is collapsed.
NOTE: This public repository is being set up. It provides the **beta version of BUSCO v2.0** that should not be used yet if you intend to use the results in a publication.
* If you want to use the last official release of BUSCO 1.x, please visit http://busco.ezlab.org/
* In the meantime, feel free to test this version that will be officially released soon.
# Development
BUSCO is developed and maintained at University of Geneva by the Zdobnov's Computational Evolutionary Genomics Group. (http://cegg.unige.ch/)
Although you cannot contribute to the code of the project, you are free to reuse the code. See the README.md for more information.
# Reporting issues
To help us debugging and improving the tool, please report any issue/request you might have when using BUSCO in this gitlab project issue tracker.
NOTE: This public repository is being set up. It provides the **beta version of BUSCO v2.0** that should not be used yet if you intend to use the results in a publication.
* If you want to use the last official release of BUSCO 1.x, please visit http://busco.ezlab.org/
* In the meantime, feel free to test this version that will be officially released soon.
---
**BUSCO - Benchmarking sets of Universal Single-Copy Orthologs.**
To get help, ``python3 BUSCO.py -h`` and ``python3 BUSCO_plot.py -h``.
See also the user guide: http://busco.ezlab.org/files/BUSCO_userguide.pdf
You can download BUSCO datasets on http://busco.ezlab.org
*Copyright (C) 2016 E. Zdobnov lab*
BUSCO is free software: you can redistribute it and/or modify
it under the terms of the GNU General Public License as published by
the Free Software Foundation, either version 3 of the License, or
(at your option) any later version. See <http://www.gnu.org/licenses/>
BUSCO is distributed in the hope that it will be useful,
but WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
GNU General Public License for more details.
\ No newline at end of file
This diff is collapsed.
>BUSCO_3
MFAAAKLIAPAARSALISNSKVYLRPLSTAVSQNSSLVQSPVVQQTKQVTLLPAVRSFQT
TPVSRDIDSAAKFIGAGAATVGVAGSGIPDDEVIAGLGSVFGSLIIGYARNSSLKEKLFS
YALLGLALSEAMGLFVLMMALLLLFAFNAKLKIVEPSYLALDKPTRASTIRETRTKPTSS
ATRSCTWPRRRATNTSSHSSTDIDGRTAQELAGMNNRDDILRFLDGVHAKLEAGDKKKAK
ARPRRFTFNKRQVKKEQVQEKLEKRMNKGHHRPSMIETLKTRIKSGSIWGRPLRGSAPSW
DAEFGVGAEAGARRRLQGAPESFYSSEGPNEESSIGPRTNTQSKTSYQTPSPATTITRTP
PWGLGEYLPRFEEQKIDLETLENPGEVTDSML
>BUSCO_4
MDFAKKQLEKYGWKEGKGLGKNENGITEPLKASLKFDNAGIGYDEAQEFNDHWWERLYDE
AAKNVEVESNQDEKVSTERKKKEEAVEISTKGYSARKLKKKKEKEASEKKSVYDNFLKTS
LLLQDGGEEKNVDREKKEDIEVAKVKTLTDEELFKACGGRTAHKGARHGLKLNGKLARIE
QQEKKLLKKLESKKKKKKVVSKNKSLEKKNTKSSETLEEKLTKELEELKEEAEKVIEDEP
ESAKKKKSKKKKSDTESASEKLASTELEEKKDKNEHKVVSIKKKKKKKKNKADEAAKEKE
EIEEVEEKKEKERLKKKLELSKTVKEIEKKVISKSKKKAKLLESEEETEDDEYVEEKKKI
KKKKKLQKESKKVKKIVEKLKKEAEAEELNKSIKKLTEFDLTEKVEANALKKKKKKKKET
KV
>BUSCO_6
LLRLLAKKEAKLAKLARAKRLYHSEKGVFGYKPVAKKEYEVAEEVLEERNEQANVYRLVE
AYRKHGHKKAAVDPISIKKEEELKELEPALYGLETQEKVRTAGLLSTEQEEQTVEELEQL
LKDIYCGSVSAEFSYLEEEEEREWLAEKVEKLLEEKLEEEERKEIAEELLKSQAFDNFLA
LKFVTVKRYGGEGAESMLAFFLELLRLSAEANIEHVVLAMAHRGRLNLLTGLLNLPPAKV
FRKLKGLSEFPDDVKATGDVISHLVVSEDLEVLGKKLHVTLLRNPSHLEAVNPVSMGKTR
AKQQALKEGAYGEEEEAKLSEKVLNVQVHGDAAFAGQGVNQECLALAKVPHFEVGGSIHL
IVNNQLGFTTPAERGRSSRYVSDLAKSISAPVIHVNGDDPEAVVRATKLALKYQRKFRKD
VFIDLNCFRRWGHNELDDPTLTNPLVYKIIKSRKSVPDEYAEKLVEEGVLTEEEVEEIRE
EYTKYLNEELKEADSYKPEASYFEKQWAGLKQAESKLTTWDTGVDLELLKFIGQKSVQVP
EDFNIHPHLLKTHVKARLKKLEEGKKLDWATAEALAIGSLLYQGYNVRISGEDVGRGTFS
HRHAMLVDQETNEIFIPLNSLEEEQTGKLEVANSILSEEAVLGFEYGLSIDSPKNLIIWE
AQFGDFANGAQIIIDTFITSGEAKWLLSSGLVMLLPHGYDGAASEHSSCRIERFLQLTDS
KETSVDGDDVNLQIVNPTTPAQYFHLLRRQLVRNFRKPLVVVAPKILLRLPAATSSLSDL
EPGTLFKNVLGDKKVEKEKVRKVILVSGKHYYALAEEREKRQAKDVAIVRLESLCPFPVQ
ELQEELAKYKKAKEFVWSQEEKRNMGAWTFVKPRFENLVGRKLKYVGREEAATPAVGIGK
VHKREVDEILAKPFEL
>BUSCO_2
MACLSTSGRVVVGSRRQKTHKLLAQLLGSRSQKAAKSSVSAAASALSAKARKAKKVKQQA
LRALKGLSLSLGKDYSDLLQSSHELSKKLKYSASSKAALRKKSSVHTQQEAGSVREIQID
PYILLEDDLKYLYDDVRKELKSGTSQEELDTIASYYFDGQGKALRPLVTILMAKAINYHL
NKESKQLVKKQRQIALISEMVHSASLVHDDVIDQSDFRRGKPSVNVLWNHKKVTMAGDYI
LSVASIMIARLRSDDVTIVLSQILTDLVQGEFMQLGSKETENERFAHYLTKTYRKTASLI
ANALKAVAVLAEADDKVAEVAFQYGRNIGLAFQLVDDLLDFVSSSEALGKPTAADLKLGL
ATAPVLFACEKYPELNAMIMRRFSEPGDVERAFELVHKSNGLEQTRFLAKKHCAEAIRLA
QELTESPYQKALIVVADLVLNRMK
>BUSCO_5
MEEAELSESESEYDSSDEELQEAFARGELKPGLNVELEEEKQKKNDVAKLKAKLEEIKLD
LPWIERLDLVNSLAPLAPELALQLEKQEQKRAKLLKGNKKLPQVKPEEDPVLNDFKREIL
FHRQAQAAVLEGIKRLKELGIKTKRPDDYFAEMAKSDEHMQKVRENLLKKQEIAARSEKV
RQLREQKKIGKKLQVEAKLKREAEKKKLLEELKKFRKGKKKDLDFLDDKKKKESKQKKSA
EKRKKRSKKFGFGGKKKGSKLNTKSSSADLDEEKRKKKKEGKKAKGAKKKKRLGKSRRIK
AKSKK
>BUSCO_1
LLKRLLLSITKVEKAIERLLLPEGEPPAALAAVDASKKLEESKSEESLKELLGDGLLWAV
PKKRRSVEKRLKRKFGVPEYVWKLLKEKTNIRVCEECGHDHEAGVLCGTCYEKVKAETKE
MQEKIQKELGLDPVEKEVIVLYEGEKDEKSDEFLKGKRIVELKKKRPSWFSKNLLQKSTQ
EPSEKKEVKPSDLA
>BUSCO_7
LAEVAKAKKAAKEESKVELNLDKSSIVDRDLLRKVIELASSLIALVELDLGKVSQEKDVI
TDLVLSIENAEEEPEVLLVESLEASAKKEVLRLVSGLSKKEKKKFRDSERARLAVLKGAF
SALSEVKLVSDAAAAIAAVAASTSILASLLDGIKAKEDSKKELLEDSAAIKILKLAVNLF
ASSLKLVLLDKLAAKDTEILKELELSLAVALMARRYDTRTTIFSPEGRLYQVEYAMEAIS
HAGTCLGILAEDGILLAAEKRNTNKLLDEVFFSEKIYKLNDDIVCSVAGITSDANVLTNE
LRLIAQRYLLQYGEAIPCEQLVSWLCDVKQAYTQYGGKRPFGVSILYMGWDKKYGYQLYQ
SDPSGNYGGWKATCIGNNSAAAVSSLKQEYKEKETTLKDAKALAIKVLSKTLDMTKLTAE
KVEMAILTREDNKTVIKILEANEVEKLIAEYDKLEAEAEAAKKEKQKSSTKSN
>BUSCO_8
MGSSQSTRKVTIENEESAGVIKISDDVVKRLKQESEAKAAESAAAEPKKPAKKPEAPAAT
ASAPSDAASSKSVVVYPELTISALQVQKQKEEELKKNDEYWRERLAELEENLQKINKILE
DEYAKAVEEVEKKFVSTKAAKKVAPCEEQKAKVLECYRKNPKETLKCSKEVQEFRKCVDQ
KRVSLLEKESELKKAKRASAQAKAS
>BUSCO_9
MAKVPSEIVSHKRKVCSLYKRALRNLEAWYDRREEYRYQAVLLRERFDKNKDIKDLREAK
KLLAEGEKELFEKKHYQPKKFANSAGGVAFEREVIPPDWVLDYWHPLEKAQYPEYFAKRE
QRKKEYVKWYEKKYGKPEEKDLEEH
>BUSCO_10
AFYKISLEHEILLHPRYFGPQLLETVKQKLYTEVEGTCTGKYGFVVAVTTIDNIGAGIIQ
PGQGFVVYPVKYKAIVFRPFKGEVLDAVVKQVNKVGMFAEIGPLSCFISHHSIPEDLQFC
PNVNPACYKSKDEDVVIQADDEIRLKIVGTRVDATGIFAIGTLMDDYLGLVSN
>BUSCO_3_1
MFAAAKLIAPAARSALISNSKVYLRPLSTAVSQNSSLVQSPVVQQTKQVTLLPAVRSFQT
TPVSRDIDSAAKFIGAGAATVGVAGSGIPDDEVIAGLGSVFGSLIIGYARNSSLKEKLFS
YALLGLALSEAMGLFVLMMALLLLFAFNAKLKIVEPSYLALDKPTRASTIRETRTKPTSS
ATRSCTWPRRRATNTSSHSSTDIDGRTAQELAGMNNRDDILRFLDGVHAKLEAGDKKKAK
ARPRRFTFNKRQVKKEQVQEKLEKRMNKGHHRPSMIETLKTRIKSGSIWGRPLRGSAPSW
DAEFGVGAEAGARRRLQGAPESFYSSEGPNEESSIGPRTNTQSKTSYQTPSPATTITRTP
PWGLGEYLPRFEEQKIDLETLENPGEVTDSML
>BUSCO_4_1
MDFAKKQLEKYGWKEGKGLGKNENGITEPLKASLKFDNAGIGYDEAQEFNDHWWERLYDE
AAKNVEVESNQDEKVSTERKKKEEAVEISTKGYSARKLKKKKEKEASEKKSVYDNFLKTS
LLLQDGGEEKNVDREKKEDIEVAKVKTLTDEELFKACGGRTAHKGARHGLKLNGKLARIE
QQEKKLLKKLESKKKKKKVVSKNKSLEKKNTKSSETLEEKLTKELEELKEEAEKVIEDEP
ESAKKKKSKKKKSDTESASEKLASTELEEKKDKNEHKVVSIKKKKKKKKNKADEAAKEKE
EIEEVEEKKEKERLKKKLELSKTVKEIEKKVISKSKKKAKLLESEEETEDDEYVEEKKKI
KKKKKLQKESKKVKKIVEKLKKEAEAEELNKSIKKLTEFDLTEKVEANALKKKKKKKKET
KV
>BUSCO_6_1
LLRLLAKKEAKLAKLARAKRLYHSEKGVFGYKPVAKKEYEVAEEVLEERNEQANVYRLVE
AYRKHGHKKAAVDPISIKKEEELKELEPALYGLETQEKVRTAGLLSTEQEEQTVEELEQL
LKDIYCGSVSAEFSYLEEEEEREWLAEKVEKLLEEKLEEEERKEIAEELLKSQAFDNFLA
LKFVTVKRYGGEGAESMLAFFLELLRLSAEANIEHVVLAMAHRGRLNLLTGLLNLPPAKV
FRKLKGLSEFPDDVKATGDVISHLVVSEDLEVLGKKLHVTLLRNPSHLEAVNPVSMGKTR
AKQQALKEGAYGEEEEAKLSEKVLNVQVHGDAAFAGQGVNQECLALAKVPHFEVGGSIHL
IVNNQLGFTTPAERGRSSRYVSDLAKSISAPVIHVNGDDPEAVVRATKLALKYQRKFRKD
VFIDLNCFRRWGHNELDDPTLTNPLVYKIIKSRKSVPDEYAEKLVEEGVLTEEEVEEIRE
EYTKYLNEELKEADSYKPEASYFEKQWAGLKQAESKLTTWDTGVDLELLKFIGQKSVQVP
EDFNIHPHLLKTHVKARLKKLEEGKKLDWATAEALAIGSLLYQGYNVRISGEDVGRGTFS
HRHAMLVDQETNEIFIPLNSLEEEQTGKLEVANSILSEEAVLGFEYGLSIDSPKNLIIWE
AQFGDFANGAQIIIDTFITSGEAKWLLSSGLVMLLPHGYDGAASEHSSCRIERFLQLTDS
KETSVDGDDVNLQIVNPTTPAQYFHLLRRQLVRNFRKPLVVVAPKILLRLPAATSSLSDL
EPGTLFKNVLGDKKVEKEKVRKVILVSGKHYYALAEEREKRQAKDVAIVRLESLCPFPVQ
ELQEELAKYKKAKEFVWSQEEKRNMGAWTFVKPRFENLVGRKLKYVGREEAATPAVGIGK
VHKREVDEILAKPFEL
>BUSCO_2_1
MACLSTSGRVVVGSRRQKTHKLLAQLLGSRSQKAAKSSVSAAASALSAKARKAKKVKQQA
LRALKGLSLSLGKDYSDLLQSSHELSKKLKYSASSKAALRKKSSVHTQQEAGSVREIQID
PYILLEDDLKYLYDDVRKELKSGTSQEELDTIASYYFDGQGKALRPLVTILMAKAINYHL
NKESKQLVKKQRQIALISEMVHSASLVHDDVIDQSDFRRGKPSVNVLWNHKKVTMAGDYI
LSVASIMIARLRSDDVTIVLSQILTDLVQGEFMQLGSKETENERFAHYLTKTYRKTASLI
ANALKAVAVLAEADDKVAEVAFQYGRNIGLAFQLVDDLLDFVSSSEALGKPTAADLKLGL
ATAPVLFACEKYPELNAMIMRRFSEPGDVERAFELVHKSNGLEQTRFLAKKHCAEAIRLA
QELTESPYQKALIVVADLVLNRMK
>BUSCO_5_1
MEEAELSESESEYDSSDEELQEAFARGELKPGLNVELEEEKQKKNDVAKLKAKLEEIKLD
LPWIERLDLVNSLAPLAPELALQLEKQEQKRAKLLKGNKKLPQVKPEEDPVLNDFKREIL
FHRQAQAAVLEGIKRLKELGIKTKRPDDYFAEMAKSDEHMQKVRENLLKKQEIAARSEKV
RQLREQKKIGKKLQVEAKLKREAEKKKLLEELKKFRKGKKKDLDFLDDKKKKESKQKKSA
EKRKKRSKKFGFGGKKKGSKLNTKSSSADLDEEKRKKKKEGKKAKGAKKKKRLGKSRRIK
AKSKK
>BUSCO_1_1
LLKRLLLSITKVEKAIERLLLPEGEPPAALAAVDASKKLEESKSEESLKELLGDGLLWAV
PKKRRSVEKRLKRKFGVPEYVWKLLKEKTNIRVCEECGHDHEAGVLCGTCYEKVKAETKE
MQEKIQKELGLDPVEKEVIVLYEGEKDEKSDEFLKGKRIVELKKKRPSWFSKNLLQKSTQ
EPSEKKEVKPSDLA
>BUSCO_7_1
LAEVAKAKKAAKEESKVELNLDKSSIVDRDLLRKVIELASSLIALVELDLGKVSQEKDVI
TDLVLSIENAEEEPEVLLVESLEASAKKEVLRLVSGLSKKEKKKFRDSERARLAVLKGAF
SALSEVKLVSDAAAAIAAVAASTSILASLLDGIKAKEDSKKELLEDSAAIKILKLAVNLF
ASSLKLVLLDKLAAKDTEILKELELSLAVALMARRYDTRTTIFSPEGRLYQVEYAMEAIS
HAGTCLGILAEDGILLAAEKRNTNKLLDEVFFSEKIYKLNDDIVCSVAGITSDANVLTNE
LRLIAQRYLLQYGEAIPCEQLVSWLCDVKQAYTQYGGKRPFGVSILYMGWDKKYGYQLYQ
SDPSGNYGGWKATCIGNNSAAAVSSLKQEYKEKETTLKDAKALAIKVLSKTLDMTKLTAE
KVEMAILTREDNKTVIKILEANEVEKLIAEYDKLEAEAEAAKKEKQKSSTKSN
>BUSCO_8_1
MGSSQSTRKVTIENEESAGVIKISDDVVKRLKQESEAKAAESAAAEPKKPAKKPEAPAAT
ASAPSDAASSKSVVVYPELTISALQVQKQKEEELKKNDEYWRERLAELEENLQKINKILE
DEYAKAVEEVEKKFVSTKAAKKVAPCEEQKAKVLECYRKNPKETLKCSKEVQEFRKCVDQ
KRVSLLEKESELKKAKRASAQAKAS
>BUSCO_9_1
MAKVPSEIVSHKRKVCSLYKRALRNLEAWYDRREEYRYQAVLLRERFDKNKDIKDLREAK
KLLAEGEKELFEKKHYQPKKFANSAGGVAFEREVIPPDWVLDYWHPLEKAQYPEYFAKRE
QRKKEYVKWYEKKYGKPEEKDLEEH
>BUSCO_10_1
AFYKISLEHEILLHPRYFGPQLLETVKQKLYTEVEGTCTGKYGFVVAVTTIDNIGAGIIQ
PGQGFVVYPVKYKAIVFRPFKGEVLDAVVKQVNKVGMFAEIGPLSCFISHHSIPEDLQFC
PNVNPACYKSKDEDVVIQADDEIRLKIVGTRVDATGIFAIGTLMDDYLGLVSN
name=sample dataset BUSCO 2.0
species=fly
domain=eukaryota
[Dolphin]
SortRole=date
Timestamp=2015,3,16,15,16,24
Version=3
ViewMode=1
This diff is collapsed.
This diff is collapsed.
This source diff could not be displayed because it is too large. You can view the blob instead.
This source diff could not be displayed because it is too large. You can view the blob instead.
This source diff could not be displayed because it is too large. You can view the blob instead.
This source diff could not be displayed because it is too large. You can view the blob instead.
This diff is collapsed.
This source diff could not be displayed because it is too large. You can view the blob instead.
This diff is collapsed.
This diff is collapsed.
BUSCO_4 422 117.288194780722 373.222222222222
BUSCO_1 194 28.3715066529464 189.236842105263
BUSCO_8 205 28.055286473303 196.891891891892
BUSCO_2 444 93.4616138180162 368.815789473684
BUSCO_7 473 107.033758211255 297.944444444444
BUSCO_3 392 127.466473990086 164.973684210526
BUSCO_6 916 193.30792658553 928.210526315789
BUSCO_5 305 105.536025952404 330.342105263158
BUSCO_9 145 1.68681514854039 144.648648648649
BUSCO_10 173 26.6633162309648 178.891891891892
[Dolphin]
Timestamp=2015,3,16,15,18,59
Version=3
ViewMode=1
[name]
unknown
[dist]
# distance from previous block
# <min> <max>
0 106
[block]
# block no. 0 follows, 38 sequences, length 17
# corresponding to MSA columns:
# 118-134
name=unknown_A
#
# <colnr> <probs for GDERKNQSTAVLIFYWHMCP>
# G D E R K N Q S T A V L I F Y W H M C P
0 0.01388 0.01107 0.01218 0.01110 0.01385 0.03971 0.00901 0.17529 0.16651 0.02492 0.16937 0.03822 0.06334 0.01120 0.00685 0.00211 0.00514 0.19362 0.00584 0.02680
1 0.01121 0.00561 0.00561 0.00561 0.00701 0.00561 0.00421 0.01402 0.01262 0.02243 0.01962 0.02243 0.01542 0.00701 0.00421 0.00140 0.00280 0.00561 0.82198 0.00561
2 0.05860 0.01265 0.05784 0.14550 0.06596 0.06046 0.07076 0.04961 0.01390 0.04879 0.07278 0.10137 0.05640 0.01037 0.04930 0.00228 0.00690 0.00718 0.00406 0.10531
3 0.01580 0.01643 0.07626 0.03477 0.16680 0.12458 0.11728 0.02196 0.15710 0.07556 0.09588 0.01952 0.01634 0.00709 0.00655 0.00189 0.02722 0.00626 0.00431 0.00839
4 0.01121 0.00561 0.00561 0.00561 0.00701 0.00561 0.00421 0.01402 0.01262 0.02243 0.01962 0.02243 0.01542 0.00701 0.00421 0.00140 0.00280 0.00561 0.82198 0.00561
5 0.75537 0.01157 0.00925 0.00824 0.01186 0.01338 0.00676 0.04559 0.01092 0.02673 0.00903 0.01069 0.00711 0.00775 0.04422 0.00227 0.00534 0.00351 0.00379 0.00660
6 0.01494 0.05135 0.01841 0.01492 0.01606 0.07270 0.01238 0.10502 0.01235 0.01739 0.00930 0.01357 0.00857 0.01147 0.05778 0.00278 0.54567 0.00515 0.00312 0.00705
7 0.01397 0.35264 0.02059 0.01073 0.01386 0.09591 0.00923 0.01569 0.01169 0.01438 0.01174 0.04114 0.01147 0.08344 0.14527 0.00336 0.07644 0.00503 0.00301 0.06039
8 0.01169 0.01111 0.01678 0.01445 0.01530 0.01446 0.06736 0.01358 0.00976 0.01468 0.01103 0.01697 0.01043 0.02189 0.27272 0.00498 0.45784 0.00581 0.00287 0.00629
9 0.01140 0.02757 0.65374 0.01586 0.02363 0.01272 0.01989 0.01759 0.01261 0.01857 0.01481 0.09513 0.03566 0.00741 0.00597 0.00197 0.00813 0.00605 0.00296 0.00834
10 0.01893 0.01092 0.05396 0.05447 0.01592 0.03100 0.00955 0.05122 0.01593 0.38294 0.05521 0.10399 0.07502 0.01011 0.00653 0.00203 0.00536 0.08250 0.00615 0.00826
11 0.53355 0.01360 0.01203 0.01155 0.05408 0.09401 0.00867 0.01751 0.01093 0.02262 0.00901 0.01196 0.00768 0.03944 0.00773 0.00212 0.12946 0.00399 0.00344 0.00662
12 0.01162 0.00944 0.01164 0.12473 0.01635 0.01058 0.00884 0.01974 0.28331 0.02231 0.24935 0.06916 0.02949 0.00968 0.00672 0.00197 0.02609 0.00827 0.07346 0.00723
13 0.00729 0.00539 0.00682 0.00795 0.00861 0.00492 0.00540 0.00842 0.01192 0.01552 0.03829 0.65042 0.17071 0.01818 0.00757 0.00237 0.00341 0.01629 0.00558 0.00492
14 0.01121 0.00561 0.00561 0.00561 0.00701 0.00561 0.00421 0.01402 0.01262 0.02243 0.01962 0.02243 0.01542 0.00701 0.00421 0.00140 0.00280 0.00561 0.82198 0.00561
15 0.46487 0.01121 0.01047 0.00836 0.01281 0.01105 0.00679 0.01655 0.01124 0.02369 0.00941 0.01098 0.00759 0.00508 0.00405 0.00143 0.00456 0.00339 0.00365 0.37283
16 0.01357 0.01356 0.01447 0.05652 0.01568 0.14570 0.01045 0.01703 0.09845 0.01566 0.01320 0.01880 0.01203 0.09197 0.15637 0.00395 0.26795 0.00578 0.02239 0.00647
[dist]
# distance from previous block
# <min> <max>
0 96
# created by:
# /software/SequenceAnalysis/GenePrediction/augustus/3.0.1/scripts/msa2prfl.pl ./aligns/BUSCO_1.fas
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
BUSCO_6 511.44
BUSCO_7 415.84
BUSCO_5 202.16
BUSCO_1 63.68
BUSCO_8 93.76
BUSCO_2 289.04
BUSCO_4 97.52000000000001
BUSCO_3 137.52
BUSCO_9 123.68
BUSCO_10 237.28000000000003
\ No newline at end of file
This diff is collapsed.
>g1[sample:25227-28731]
MEASAAKITPMASSTSTSGSINSPSSDKMNYALQVALQTIKERCIQLQRRVASMEEENQRLREASSRSEGAPTAKEIGVTGDVLSLKAQVSELQRQKEQLEEHISMVSNENRRLWSRLSQISKDQQLNAVPSSSDSRAQQNQNLVRSKTFTQHSPNPHLRQKMLSDGIKDLSLEEIALDDFGASSGELGYPYNLQKVEETTSEPDANVDAKRCMDGLQEMRREAMKQQQELSSALTLLESRIALKPCPECAQKTFKKPEMADKSLETDDSLTSELKNYESQHNGHNGTPPSQRINIIQEKIKADAADAMEKICPMCGKQYSSQVSFNAFREHVEMHFIDDALELESENSMERQFEFVSHA
>g2[sample:28912-30181]
MFCGKSLVNNFYKYKRKMWQNVVPIIQRGKGTYHPLKILFFGTDYFSLPSLQALHKNCGDHLGVVTSFKNPANCVRTYAEKEKLPLQKWPIDPSVCPKFDLGVVVSFGHLIPANIIHGFPNGMINVHASLLPRWRGAAPIIYAIMKGDAITGVSIMKIEPHRFDIGAILAQREVAIEPNVFMPDLHASLASLGADLLVDTVNNLSVRLKEAKPQDSTKTSYAPKITSKITEVNWSELSALDIYTRHRALFGYKNLTTSFLSKQVQLLELPEEGEIPGNWMCSAQPVGGASITRRR
>g3[sample:30184-31421]
MSRNLFLSITNLFRNLESLFLPHGGHPPALALAGFQHDHSHRSSQEFSLKQLIGDGMLWAVPKHRRSVEKRLKRKFGYPEYNWKPLREKRNIRSCLQCGHDHEMGVLCPFCYQKVLKETELMQSKIQETLGLDPVDKEVIVLYEGEKAEQSSDELKNKRIVEMKKPRPMWFTKNLLQKSTQQLSETKEVKPSDLA
>g4[sample:31632-32490]
MACLSTSGRVVCGSRRQQTHKLLYQLFGSRPGYTAPSTATGLFSPPKVQQQAMRLCHGLSFSLGKDYPDLLVSSLPDEAYTAKK
>g1[sample:164350-165618]
MAVASAANSGRDYLPRPQARAYVYGTPPPSTMAQLRRIIQGHLERFQQAEQTHFSRRANVQLGKSELPAERKPLAMQLWVVRTPAVSGAASDNVLDYALPPNTPTPKDYAHKFLPEGKDVVPGSSYIPLRLVVIKR
>g2[sample:168309-169293]
MARLYDSRTTIFSPEGRLYQVEYAMEAASQSNTCLGILAKNGVILATERSVDKLLDSSIPAPRICRLNEDAACCATGNKADGNVLTTELRLIAQQYVSTYGEMIPCEQLVTNLCDIKQAYTQYGGKRPFGVSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYASPSLEEAKDVAIKVMGMTLDRDSLTPAKLEMAVLQRFYNTTIFHILEKIEVHNLIQKHNILQFQIARRKY
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
This diff is collapsed.
Markdown is supported
0%
or
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment